PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G20120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 229aa    MW: 24215.7 Da    PI: 10.5876
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G20120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC802.2e-25136180145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      ++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+
  OPUNC04G20120.1 136 EPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPMEA 180
                      69***************************************9997 PP

2QLQ552.4e-1970106137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      sa+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k
  OPUNC04G20120.1  70 SALTFMQRQELEHQVLIYRYFAAGAPVPVHLVLPIWK 106
                      799*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.2E-670106IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.5E-1171105IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.43371106IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.072136180IPR014977WRC domain
PfamPF088798.9E-21137178IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006995Biological Processcellular response to nitrogen starvation
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009624Biological Processresponse to nematode
GO:0009631Biological Processcold acclimation
GO:0016036Biological Processcellular response to phosphate starvation
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0050826Biological Processresponse to freezing
GO:0051365Biological Processcellular response to potassium ion starvation
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005524Molecular FunctionATP binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MLAEGRKVYS PPPSKLPRLS GTGPNDGVVT MAAPSPLLLG LALGLGGSGS DSSGSDAEAS  60
AATVREARPS ALTFMQRQEL EHQVLIYRYF AAGAPVPVHL VLPIWKSVAA SLFGPHSFPS  120
LTGLGSLCFD YRSSMEPEPG RCRRTDGKKW RCSRDVVPGH KYCERHVHRG RGRSRKPMEA  180
SAAVTPTSLP VRPALHTAAT LATSAPSSPH LGFSSASKVL LAHTTARAT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169177GRGRSRKPM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1109340.0AK110934.1 Oryza sativa Japonica Group cDNA clone:002-173-G02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635359.11e-125PREDICTED: growth-regulating factor 12
SwissprotQ6AWX71e-127GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLA0A0E0KU771e-164A0A0E0KU77_ORYPU; Uncharacterized protein
STRINGBGIOSGA016961-PA1e-125(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62213051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.12e-38growth-regulating factor 3